Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50406001
Substrate/Competitorn/a
Meas. Tech.ChEMBL_53931
pH7.2±n/a
Ki 5370±n/a nM
Commentsextracted
Citation Li, RHansch, CKaufman, BT A comparison of the inhibitory action of 5-(substituted-benzyl)-2,4-diaminopyrimidines on dihydrofolate reductase from chicken liver with that from bovine liver. J Med Chem25:435-40 (1982) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:21603.71
Organism:Bos taurus (Cattle)
Description:P00376
Residue:187
Sequence:
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50406001
NameBDBM50406001
Synonyms:CHEMBL416177
TypeSmall organic molecule
Emp. Form.C12H14N4
Mol. Mass.214.2664
SMILESCc1ccc(Cc2cnc(N)nc2N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a