Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50405973
Substrate/Competitorn/a
Meas. Tech.ChEBML_54731
Ki 224±n/a nM
Citation Li, RLPoe, M Quantitative structure-activity relationships for the inhibition of Escherichia coli dihydrofolate reductase by 5-(substituted benzyl)-2,4-diaminopyrimidines. J Med Chem31:366-70 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:Dihydrofolate reductase (F31V) | dfrA17
Type:n/a
Mol. Mass.:17532.46
Organism:Escherichia coli
Description:n/a
Residue:157
Sequence:
MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405973
NameBDBM50405973
Synonyms:CHEMBL417095
TypeSmall organic molecule
Emp. Form.C11H11ClN4
Mol. Mass.234.685
SMILESNc1ncc(Cc2cccc(Cl)c2)c(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a