Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSterol O-acyltransferase, Soat
LigandBDBM50229235
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28353
IC50 4.7±n/a nM
Citation Larsen, SDSpilman, CHBell, FPDinh, DMMartinborough, EWilson, GJ Synthesis and hypocholesterolemic activity of 6,7-dihydro-4H-pyrazolo[1,5-a]pyrrolo[3,4-d]pyrimidine-5,8-diones, novel inhibitors of acylCoA:cholesterol O-acyltransferase. J Med Chem34:1721-7 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sterol O-acyltransferase, Soat
Name:Sterol O-acyltransferase, Soat
Synonyms:ACAT-1 | Cholesterol acyltransferase 1
Type:PROTEIN
Mol. Mass.:64165.56
Organism:Rattus norvegicus
Description:ChEMBL_28796
Residue:545
Sequence:
MVGEETSLRNRLSRSAENPEQDEAQKNLLDTHRNGHITMKQLIAKKRQLAAEAEELKPLF
LKEVGCHFDDFVTNLIDKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEQGKIFISR
RSLLDELFEVDHIRTIYHMFIALLIIFILSTLVVDYIDEGRLVLEFSLLAYAFGQFPIVI
WTWWAMFLSTLAIPYFLFQRWAHGYSKSSHPLIYSLIHGAFFLVFQLGILGFIPTYVVLA
YTLPPASRFILILEQIRLVMKAHSYVRENVPRVLSAAKEKSSTVPVPTVNQYLYFLFAPT
LIYRDSYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLC
VFNSILPGVLMLFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVH
DWLYYYVYKDLLWFFSKRFRPAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGMA
FNFIVNDSRKRPVWNIMVRASLFLGHGVILCFYSQEWYARQRCPLKNPTFLDYVRPRTWT
CRYVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229235
NameBDBM50229235
Synonyms:CHEMBL46610
TypeSmall organic molecule
Emp. Form.C28H22N4O2
Mol. Mass.446.4999
SMILESO=C1N(Cc2ccccc2)Cc2c1n(Cc1ccccc1)c1cc(nn1c2=O)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a