Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOpioid receptor homologue
LigandBDBM50001465
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1650832
Ki 73±n/a nM
Citation Rosa, MGonzalez-Nunez, VBarreto-Valer, KMarcelo, FSánchez-Sánchez, JCalle, LPArévalo, JCRodríguez, REJiménez-Barbero, JArsequell, GValencia, G Role of the sugar moiety on the opioid receptor binding and conformation of a series of enkephalin neoglycopeptides. Bioorg Med Chem25:2260-2265 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Opioid receptor homologue
Name:Opioid receptor homologue
Synonyms:Opioid receptor homologue | Synonyms=oprd1 | oprd1a
Type:PROTEIN
Mol. Mass.:42534.96
Organism:Danio rerio
Description:ChEMBL_117502
Residue:373
Sequence:
MEPSVIPGADIPDLYSINPFNVTFPDDVLSFVPDGRNYTEPNPVKSRGIIIAISITALYS
VICVVGLLGNILVMYGVVRYTKLKTATNIYIFNLALADALATSTLPFQSTKYLMNTWPFG
ELLCKVVIAIDYYNMFTSIFTLTMMSVDRYIAVCHPVRALEFRTPIKAKIINVCIWILSS
AVGVPIMIMAVTRVTNQNTTVCMLKFPDPDWYWDTVTKICVFIFAFVVPVLVITICYGLM
ILRLKSVRLLSGSKEKDRNMRRITRMVLVVVAAFIICWTPIHIFIIEKTLVDINQKNPFV
IASWHLHRTGYTNSSLNPVLYAFLDENFKRCFRDFCLPFRTRADQSNLNRARNATREPVS
VCALRIQERSRYD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001465
NameBDBM50001465
Synonyms:(S)-2-[(S)-2-(2-{2-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid | ([Leu]-enkephalin)2-[2-(2-{2-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid | (enkephalin)2-[2-(2-{2-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid | 2-[(S)-2-(2-{2-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-acetylamino}-acetylamino)-1-oxo-3-phenyl-propylamino]-4-methyl-pentanoic acid | 2-[(S)-2-(2-{2-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid | 2-[1-[1-amino-2-(4-hydroxyphenyl)-(1S)-ethylcarboxamidomethylcarboxamidomethylcarboxamido]-2-phenyl-(1S)-ethylcarboxamido]-4-methyl-(2S)-pentanoic acid | 2-[2-(2-{2-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid | 2-[2-(2-{2-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid(Enkephalin) | 2-{1-[1-amino-2-(4-hydroxyphenyl)ethylcarboxamidomethylcarboxamidomethylcarboxamido]-2-phenylethylcarboxamido}-4-methylpentanoic acid | CHEMBL8234 | ENKEPHALIN | Leu-ENKEPHALIN | Leu5-Enkephalin | Tyr-Gly-Gly-Phe-Leu-OH
TypeSmall organic molecule
Emp. Form.C28H37N5O7
Mol. Mass.555.6227
SMILESCC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a