Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor 44
LigandBDBM50233520
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1650967
IC50 0.400000±n/a nM
Citation Sandham, DABarker, LBrown, LBrown, ZBudd, DCharlton, SJChatterjee, DCox, BDubois, GDuggan, NHall, EHatto, JMaas, JManini, JProfit, RRiddy, DRitchie, CSohal, BShaw, DStringer, RSykes, DAThomas, MTurner, KLWatson, SJWest, RWillard, EWilliams, GWillis, J Discovery of Fevipiprant (NVP-QAW039), a Potent and Selective DP ACS Med Chem Lett8:582-586 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor 44
Name:G protein-coupled receptor 44
Synonyms:CD_antigen=CD294 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | G-protein coupled receptor 44 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2)
Type:Enzyme
Mol. Mass.:43295.45
Organism:Homo sapiens (Human)
Description:Q9Y5Y4
Residue:395
Sequence:
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50233520
NameBDBM50233520
Synonyms:FEVIPIPRANT | Fevipiprant | NVP-QAW039 | QAW039
TypeSmall organic molecule
Emp. Form.C19H17F3N2O4S
Mol. Mass.426.409
SMILESCc1c(CC(O)=O)c2cccnc2n1Cc1ccc(cc1C(F)(F)F)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a