Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-galactosidase A
LigandBDBM50234565
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1653300
IC50 13000±n/a nM
Citation Cheng, WCWang, JHYun, WYLi, HYHu, JM Rapid preparation of (3R,4S,5R) polyhydroxylated pyrrolidine-based libraries to discover a pharmacological chaperone for treatment of Fabry disease. Eur J Med Chem126:1-6 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-galactosidase A
Name:Alpha-galactosidase A
Synonyms:Alpha-D-galactosidase A | Alpha-D-galactoside galactohydrolase | INN=Agalsidase | Melibiase
Type:Protein
Mol. Mass.:48760.21
Organism:Homo sapiens (Human)
Description:n/a
Residue:429
Sequence:
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENL
ADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK
SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIG
GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT
MQMSLKDLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50234565
NameBDBM50234565
Synonyms:CHEMBL4093453
TypeSmall organic molecule
Emp. Form.C16H24N2O5
Mol. Mass.324.3722
SMILESCOc1cccc(CCC(=O)NC[C@H]2N[C@H](CO)[C@H](O)[C@@H]2O)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a