Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 14
LigandBDBM7458
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
Temperature310.15±0 K
IC50 1.43e+4± 7e+2 nM
Citation Goettert, MSchattel, VKoch, PMerfort, ILaufer, S Biological evaluation and structural determinants of p38α mitogen-activated-protein kinase and c-Jun-N-terminal kinase 3 inhibition by flavonoids. Chembiochem11:2579-88 (2010) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 14
Name:Mitogen-activated protein kinase 14
Synonyms:CSAID-binding protein | CSBP | Cytokine suppressive anti-inflammatory drug-binding protein | MAP Kinase p38 alpha | MAP kinase MXI2 | MAP kinase p38 | MAX-interacting protein 2 | Mitogen-activated protein kinase (MAP) p38 alpha | Mitogen-activated protein kinase (Map p38 alpha) | Mitogen-activated protein kinase 14 (MAP kinase p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14 p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKa) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKÿ±) | Mitogen-activated protein kinase 14 (p38 MAPKa) | Mitogen-activated protein kinase 14 (p38 alpha) | Mitogen-activated protein kinase 14, activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha (p38 MAPKa) | SAPK2A | p38-alpha
Type:Serine/threonine-protein kinase
Mol. Mass.:41286.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7458
NameBDBM7458
Synonyms:5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | Apigenin | Apigenin (2) | Apigenin (3) | Apigenin (7) | Apigenin, 13 | CHEMBL28 | Naringenin, 18 | cid_5280443
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)cc(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a