Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA A receptor alpha-1/beta-1/gamma-2
LigandBDBM81951
Substrate/Competitorn/a
Ki 7.5±n/a nM
CommentsPDSP_689
Citation Scholze, PEbert, VSieghart, W Affinity of various ligands for GABAA receptors containing alpha 4 beta 3 gamma 2, alpha 4 gamma 2, or alpha 1 beta 3 gamma 2 subunits. Eur J Pharmacol304:155-62 (1996) [PubMed]
More Info.:Get all data from this article
 
GABA A receptor alpha-1/beta-1/gamma-2
Name:Gamma-aminobutyric acid receptor subunit alpha-1/ beta-1
Synonyms:GABA A Alpha1Beta1Gamma2 | GABA A Alpha1Beta2Gamma2 | GABA A Alpha1Beta3Gamma2 | GABA A Benzodiazepine brain | GABA A Benzodiazepine liver | GABA receptor alpha-1 subunit | GABA(A) receptor subunit alpha-1 | GABA-A | GABA-A receptor | Gamma-aminobutyric acid receptor subunit alpha (GABAA) | Gamma-aminobutyric acid receptor subunit alpha-1 | TBPS | agonist GABA site
Type:Protein
Mol. Mass.:51817.35
Organism:Homo sapiens (Human)
Description:P14867
Residue:456
Sequence:
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81951
NameBDBM81951
Synonyms:CAS_104999 | DMCM | NSC_104999
TypeSmall organic molecule
Emp. Form.C17H18N2O4
Mol. Mass.314.3358
SMILESCCc1c(ncc2[nH]c3cc(OC)c(OC)cc3c12)C(=O)OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a