Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM81448
Substrate/Competitorn/a
Ki 217±n/a nM
CommentsPDSP_984
Citation Pälvimäki, EPRoth, BLMajasuo, HLaakso, AKuoppamäki, MSyvälahti, EHietala, J Interactions of selective serotonin reuptake inhibitors with the serotonin 5-HT2c receptor. Psychopharmacology (Berl)126:234-40 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 2A
Name:5-hydroxytryptamine receptor 2A
Synonyms:5-HT-2A | 5-HT2 | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2A | Serotonin Receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52852.05
Organism:Rattus norvegicus (rat)
Description:Rat cortex membranes 5-HT2A receptors.
Residue:471
Sequence:
MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYK
SSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81448
NameBDBM81448
Synonyms:CAS_5560-72-5 | IPRINDOLE | NSC_21722
TypeSmall organic molecule
Emp. Form.C19H28N2
Mol. Mass.284.439
SMILESCN(C)CCCn1c2CCCCCCc2c2ccccc12
Structure
n/a