Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM22914
Substrate/Competitorn/a
Ki 3.98±n/a nM
CommentsPDSP_1847
Citation Brown, JDO'Shaughnessy, CTKilpatrick, GJScopes, DIBeswick, PClitherow, JWBarnes, JC Characterisation of the specific binding of the histamine H3 receptor antagonist radioligand [3H]GR168320. Eur J Pharmacol311:305-10 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
HRH3
Name:HRH3
Synonyms:HISTAMINE H3 | Hrh3 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:37860.96
Organism:RAT
Description:Q5PPG3
Residue:344
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRGSKPSASSASLEKRMKMVSQSITQRF
RLSRDKKVAKSLAIIVSIFGLCWAPYTLLMIIRAACHGRCIPDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22914
NameBDBM22914
Synonyms:CHEMBL260374 | N-cyclohexyl-4-(1H-imidazol-5-yl)piperidine-1-carbothioamide | Thioperamide
TypeSmall organic molecule
Emp. Form.C15H24N4S
Mol. Mass.292.443
SMILESS=C(NC1CCCCC1)N1CCC(CC1)c1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a