Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM81790
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_287
Citation Schoemaker, HClaustre, YFage, DRouquier, LChergui, KCuret, OOblin, AGonon, FCarter, CBenavides, JScatton, B Neurochemical characteristics of amisulpride, an atypical dopamine D2/D3 receptor antagonist with both presynaptic and limbic selectivity. J Pharmacol Exp Ther280:83-97 (1997) [PubMed]
More Info.:Get all data from this article
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:ANGIOTENSIN AT1 | Angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41009.15
Organism:RABBIT
Description:ANGIOTENSIN AT1 AGTR1 RABBIT::P34976
Residue:359
Sequence:
MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81790
NameBDBM81790
Synonyms:Amisulpride | CAS_71675-85-9 | NSC_2159 | US10167256, Amisulpride
TypeSmall organic molecule
Emp. Form.C17H27N3O4S
Mol. Mass.369.479
SMILESCCN1CCCC1CNC(=O)c1cc(c(N)cc1OC)S(=O)(=O)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a