Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT2
LigandBDBM81790
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_287
Citation Schoemaker, HClaustre, YFage, DRouquier, LChergui, KCuret, OOblin, AGonon, FCarter, CBenavides, JScatton, B Neurochemical characteristics of amisulpride, an atypical dopamine D2/D3 receptor antagonist with both presynaptic and limbic selectivity. J Pharmacol Exp Ther280:83-97 (1997) [PubMed]
More Info.:Get all data from this article
 
Angiotensin II AT2
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41346.62
Organism:RAT
Description:Angiotensin II AT2 0 0::P35351
Residue:363
Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81790
NameBDBM81790
Synonyms:Amisulpride | CAS_71675-85-9 | NSC_2159
TypeSmall organic molecule
Emp. Form.C17H27N3O4S
Mol. Mass.369.479
SMILESCCN1CCCC1CNC(=O)c1cc(c(N)cc1OC)S(=O)(=O)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a