Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD1
LigandBDBM67544
Substrate/Competitorn/a
Ki 530±n/a nM
CommentsPDSP_1909
Citation Creese, IBurt, DRSnyder, SH Dopamine receptor binding predicts clinical and pharmacological potencies of antischizophrenic drugs. J Neuropsychiatry Clin Neurosci8:223-6 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
DRD1
Name:Dopamine receptor
Synonyms:D(1A) dopamine receptor | DOPAMINE D1
Type:Enzyme Catalytic Domain
Mol. Mass.:49330.65
Organism:BOVINE
Description:DOPAMINE D1 DRD1 BOVINE::Q95136
Residue:446
Sequence:
MRTLNTSTMEGTGLVAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTGPSEGNATSLG
KTINNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN
CQTTTGNGNPMECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS
GETKPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNVVYLIPHAVGSSEGLKKEEAVGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67544
NameBDBM67544
Synonyms:N,N-dimethyl-3-[2-(trifluoromethyl)-10-phenothiazinyl]-1-propanamine;hydrochloride | N,N-dimethyl-3-[2-(trifluoromethyl)phenothiazin-10-yl]propan-1-amine;hydrochloride | SR-01000000224-4 | TRIFLUPROMAZINE | cid_66069 | dimethyl-[3-[2-(trifluoromethyl)phenothiazin-10-yl]propyl]amine;hydrochloride
TypeSmall organic molecule
Emp. Form.C18H19F3N2S
Mol. Mass.352.417
SMILESCN(C)CCCN1c2ccccc2Sc2ccc(cc12)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a