Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM81486
Substrate/Competitorn/a
Ki 1.9±n/a nM
CommentsPDSP_1249
Citation Creese, IBurt, DRSnyder, SH Dopamine receptor binding predicts clinical and pharmacological potencies of antischizophrenic drugs. J Neuropsychiatry Clin Neurosci8:223-6 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
DRD2
Name:Dopamine receptor
Synonyms:DOPAMINE D2 | Dopamine D2 receptor | Dopamine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:50698.79
Organism:BOVINE
Description:DOPAMINE D2 DRD2 BOVINE::P20288
Residue:444
Sequence:
MDPLNLSWYDDDPESRNWSRPFNGSEGKADRPPYNYYAMLLTLLIFVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKTVNPKIAKIFEIQSMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81486
NameBDBM81486
Synonyms:CAS_1050-79-9 | MOPERONE | NSC_4249
TypeSmall organic molecule
Emp. Form.C22H26FNO2
Mol. Mass.355.4457
SMILESCc1ccc(cc1)C1(O)CCN(CCCC(=O)c2ccc(F)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a