Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM82472
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_456
Citation Kennett, GAAinsworth, KTrail, BBlackburn, TP BW 723C86, a 5-HT2B receptor agonist, causes hyperphagia and reduced grooming in rats. Neuropharmacology36:233-9 (1997) [PubMed]
More Info.:Get all data from this article
 
Beta-1 adrenergic receptor
Name:Beta-1 adrenergic receptor
Synonyms:ADRB1 | Adrenergic receptor | adrenergic Beta1
Type:Enzyme Catalytic Domain
Mol. Mass.:50540.48
Organism:GUINEA PIG
Description:adrenergic Beta1 ADRB1 GUINEA PIG::B0FL73
Residue:467
Sequence:
MGAGVLALGASEPCNLSSTAPLPDGAATAARLLVPASPPASLLPPTSEGSEPLSPQWTAG
MGLLMVLIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARVLVC
TVWAISALVSFLPILMHWWRAEGDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPGRPPSPVPSPTPGSPRAATDPLANGRTSKRR
PSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANS
AFNPIIYCRSPDFRKAFQRLLCCARRAARRRHTAHGGRPRASGCLARSGPPPSPGAASDE
DEDAVGAAPPARLLEPWAGCNGGAATADSDWSLDEPGRAGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82472
NameBDBM82472
Synonyms:BW-723C86 | CAS_5311036 | NSC_5311036
TypeSmall organic molecule
Emp. Form.C16H18N2OS
Mol. Mass.286.392
SMILESCC(N)Cc1c[nH]c2ccc(OCc3cccs3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a