Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Hydroxytryptamine receptor 7 (5-HT7)
LigandBDBM82087
Substrate/Competitorn/a
Ki 0.50±n/a nM
CommentsPDSP_172
Citation Eglen, RMJasper, JRChang, DJMartin, GR The 5-HT7 receptor: orphan found. Trends Pharmacol Sci18:104-7 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
5-Hydroxytryptamine receptor 7 (5-HT7)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-HT7b | 5-hydroxytryptamine receptor 7 | 5HT7 | HTR7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:53573.08
Organism:Homo sapiens (Human)
Description:P34969
Residue:479
Sequence:
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82087
NameBDBM82087
Synonyms:2-(5-methoxy-1H-indol-3-yl)ethanamine | 5-MT | 5-Methoxytryptamine hydrochloride | CAS_66-83-1 | tryptamine, 5-Methoxy
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESCOc1ccc2[nH]cc(CCN)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a