Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin receptor
LigandBDBM35714
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1416
Citation Tahara, ATomura, YWada, KIKusayama, TTsukada, JTakanashi, MYatsu, TUchida, WTanaka, A Pharmacological profile of YM087, a novel potent nonpeptide vasopressin V1A and V2 receptor antagonist, in vitro and in vivo. J Pharmacol Exp Ther282:301-8 (1997) [PubMed]
More Info.:Get all data from this article
 
Vasopressin receptor
Name:Vasopressin receptor
Synonyms:AVPR1B | VASOPRESSIN V1B | Vasopressin V1b receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:47104.48
Organism:RAT
Description:VASOPRESSIN V1B AVPR1B RAT::P48974
Residue:425
Sequence:
MNSEPSWTATPSPGGTLPVPNATTPWLGRDEELAKVEIGILATVLVLATGGNLAVLLTLG
RHGHKRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLRQPSQSTYPLIAAPWLLAAILSLPQVFIFSLREVIQG
SGVLDCWADFYFSWGPRAYITWTTMAIFVLPVAVLSACYGLICHEIYKNLKVKTQAGREE
RRGWRTWDKSSSSAVATAATRGLPSRVSSISTISRAKIRTVKMTFVIVLAYIACWAPFFS
VQMWSVWDENAPNEDSTNVAFTISMLLGNLSSCCNPWIYMGFNSRLLPRSLSHHACCTGS
KPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATM
ETSIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35714
NameBDBM35714
Synonyms:CHEMBL420762 | Mozavaptan | N-[4-(5-Dimethylamino-2,3,4,5-tetrahydro-benzo[b]azepine-1-carbonyl)-phenyl]-2-methyl-benzamide | OPC-31260
TypeSmall organic molecule
Emp. Form.C27H29N3O2
Mol. Mass.427.5381
SMILESCN(C)C1CCCN(C(=O)c2ccc(NC(=O)c3ccccc3C)cc2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a