Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent serotonin transporter
LigandBDBM29136
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_6527
Citation Tatsumi, MGroshan, KBlakely, RDRichelson, E Pharmacological profile of antidepressants and related compounds at human monoamine transporters. Eur J Pharmacol340:249-58 (1997) [PubMed]
More Info.:Get all data from this article
 
Sodium-dependent serotonin transporter
Name:Sodium-dependent serotonin transporter
Synonyms:5-HT Transporter | 5HT transporter | 5HTT | SERT | SLC6A4 | Serotonin Transporter (SERT) | Serotonin transporter (5HTT) | Serotonin transporter protein (SERT) | Sodium-dependent serotonin transporter (SERT) | Solute carrier family 6 member 4
Type:Multi-pass membrane protein
Mol. Mass.:70322.51
Organism:Homo sapiens (Human)
Description:P31645
Residue:630
Sequence:
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29136
NameBDBM29136
Synonyms:CHEMBL92401 | Euphozid | Iprazid | Iproniazid
TypeSmall organic molecule
Emp. Form.C9H13N3O
Mol. Mass.179.219
SMILESCC(C)NNC(=O)c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a