Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA2A
LigandBDBM50159249
Substrate/Competitorn/a
Ki 9.33±n/a nM
CommentsPDSP_5979
Citation Jasper, JRLesnick, JDChang, LKYamanishi, SSChang, TKHsu, SADaunt, DABonhaus, DWEglen, RM Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol55:1035-43 (1998) [PubMed]
More Info.:Get all data from this article
 
ADRA2A
Name:ADRA2A
Synonyms:Alpha-2A adrenergic receptor | adrenergic Alpha2A
Type:Enzyme Catalytic Domain
Mol. Mass.:48888.08
Organism:MOUSE
Description:adrenergic Alpha2A ADRA2A MOUSE::Q01338
Residue:450
Sequence:
MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGG
QQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACS
APPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSE
HAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQLFNFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159249
NameBDBM50159249
Synonyms:CHEMBL16293 | Naphthalen | Naphthalin | naftaleno | naftalina | naphtalene | naphtaline | naphthalene
TypeSmall organic molecule
Emp. Form.C10H8
Mol. Mass.128.1705
SMILESc1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a