Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase-1 (COX-1)
LigandBDBM50174201
Substrate/Competitorn/a
Ki 260±n/a nM
CommentsPDSP_3988
Citation Cryer, BFeldman, M Cyclooxygenase-1 and cyclooxygenase-2 selectivity of widely used nonsteroidal anti-inflammatory drugs. Am J Med104:413-21 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Cyclooxygenase-1 (COX-1)
Name:Cyclooxygenase
Synonyms:COX-1 | Cyclooxygenase-1 | Prostaglandin G/H synthase (cyclooxygenase)
Type:Enzyme
Mol. Mass.:68692.62
Organism:Homo sapiens (Human)
Description:P23219
Residue:599
Sequence:
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50174201
NameBDBM50174201
Synonyms:ARTHROTEC | DICLOFENAC SODIUM | GP 45840 | SOLARAZE | Sodium; [2-(2,6-dichloro-phenylamino)-phenyl]-acetate | VOLTAREN | VOLTAREN-XR | diclofenac sodium | sodium 2-(2-(2,6-dichlorophenylamino)phenyl)acetate
TypeSmall organic molecule
Emp. Form.C14H10Cl2NO2
Mol. Mass.295.141
SMILES[O-]C(=O)Cc1ccccc1Nc1c(Cl)cccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a