Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA1B
LigandBDBM78940
Substrate/Competitorn/a
Ki 0.50±n/a nM
CommentsPDSP_1219
Citation Wikberg-Matsson, AWikberg, JEUhlén, S Characterization of alpha1-adrenoceptor subtypes in the pig. Eur J Pharmacol347:301-9 (1998) [PubMed]
More Info.:Get all data from this article
 
ADRA1B
Name:ADRA1B
Synonyms:adrenergic Alpha1B
Type:Enzyme Catalytic Domain
Mol. Mass.:34826.67
Organism:PIG
Description:Q70HQ0
Residue:316
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM78940
NameBDBM78940
Synonyms:METHIOTHEPIN | MLS000859918 | Methiothepin mesylate salt | SMR000326779 | cid_3039995 | mesylic acid;1-methyl-4-[3-(methylthio)-5,6-dihydrobenzo[b][1]benzothiepin-5-yl]piperazine | methanesulfonic acid;1-methyl-4-(3-methylsulfanyl-5,6-dihydrobenzo[b][1]benzothiepin-5-yl)piperazine | methanesulfonic acid;1-methyl-4-[3-(methylthio)-5,6-dihydrobenzo[b][1]benzothiepin-5-yl]piperazine
TypeSmall organic molecule
Emp. Form.C20H24N2S2
Mol. Mass.356.548
SMILESCSc1ccc2Sc3ccccc3CC(N3CCN(C)CC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a