Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target17-beta-hydroxysteroid dehydrogenase type 3
LigandBDBM7458
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.45±0
Temperature310.15±0 K
IC50 1.64e+4± 0 nM
Citation Le Lain, RNicholls, PJSmith, HJMaharlouie, FH Inhibitors of human and rat testes microsomal 17beta-hydroxysteroid dehydrogenase (17beta-HSD) as potential agents for prostatic cancer. J Enzym Inhib16:35-45 (2001) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
17-beta-hydroxysteroid dehydrogenase type 3
Name:Estradiol 17-beta-dehydrogenase 3
Synonyms:Estradiol 17-beta-dehydrogenase 3
Type:Enzyme
Mol. Mass.:34525.39
Organism:Homo sapiens (Human)
Description:P37058
Residue:310
Sequence:
MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGI
GKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKL
AGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLI
LNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLN
TNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYV
AYLKLNTKVR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7458
NameBDBM7458
Synonyms:5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | Apigenin | Apigenin (2) | Apigenin (3) | Apigenin (7) | Apigenin, 13 | CHEMBL28 | Naringenin, 18 | cid_5280443
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)cc(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a