Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin N-acetyltransferase (AANAT)
LigandBDBM85587
Substrate/Competitorn/a
Meas. Tech.AANAT Assay
pH6.8±0
Temperature310.15±0 K
IC50 6.1e+2± 8e+1 nM
Citation Beaurain, NMésangeau, CChavatte, PFerry, GAudinot, VBoutin, JADelagrange, PBennejean, CYous, S Design, synthesis and in vitro evaluation of novel derivatives as serotonin N-acetyltransferase inhibitors. J Enzyme Inhib Med Chem17:409-14 (2002) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serotonin N-acetyltransferase (AANAT)
Name:Serotonin N-acetyltransferase (AANAT)
Synonyms:Aralkylamine N-acetyltransferase
Type:Protein
Mol. Mass.:23350.36
Organism:Homo sapiens (Human)
Description:Q16613
Residue:207
Sequence:
MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVL
GVCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAH
LHVLAVHRAFRQQGRGPILLWRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCA
ITVGSLTFMELHCSLRGHPFLRRNSGC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85587
NameBDBM85587
Synonyms:AANAT Inhibitor, 8d
TypeSmall organic molecule
Emp. Form.C13H14BrNO2S
Mol. Mass.328.225
SMILESCOc1ccc2scc(CCNC(=O)CBr)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a