Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADORA3
LigandBDBM85618
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2330
Citation Varani, KMerighi, SGessi, SKlotz, KNLeung, EBaraldi, PGCacciari, BRomagnoli, RSpalluto, GBorea, PA [(3)H]MRE 3008F20: a novel antagonist radioligand for the pharmacological and biochemical characterization of human A(3) adenosine receptors. Mol Pharmacol57:968-75 (2000) [PubMed]
More Info.:Get all data from this article
 
ADORA3
Name:ADORA3
Synonyms:ADENOSINE A3 | Adora3 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:25707.75
Organism:RAT
Description:Q4V8H0
Residue:232
Sequence:
MEPLLLLSLALFSDAMVMDEKVKSGVELDTASAICNYDAHYKDHTKYWCRGYFRDSCNII
AFTPNSSNRVALKDTGDQLIITVSCLVKEDTGWYWCGIQRDFARDDMDFTKLIVTDNRED
RANGLSPGTSGNRTRSCKTSKAVQKAEGSRMSILIVCVLISGLGIIFLISHMSRGRRSQR
NRGVTGKSINRNPQASQAPSMVSIPLTVLPKVPRQNGQQKALQWTGNATKTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85618
NameBDBM85618
Synonyms:CHEMBL302765 | J1.251.181G | MRE 3008F20
TypeSmall organic molecule
Emp. Form.C21H20N8O3
Mol. Mass.432.4353
SMILESCCCn1cc2c(n1)nc(NC(=O)Nc1ccc(OC)cc1)n1nc(nc21)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a