Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene 2
LigandBDBM50009073
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1992
Citation Wang, SGustafson, EPang, LQiao, XBehan, JMaguire, MBayne, MLaz, T A novel hepatointestinal leukotriene B4 receptor. Cloning and functional characterization. J Biol Chem275:40686-94 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
Leukotriene 2
Name:Leukotriene B4 receptor
Synonyms:LTB4 receptor JULF2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2
Type:Enzyme Catalytic Domain
Mol. Mass.:41553.59
Organism:Homo sapiens (Human)
Description:Leukotriene 2 0 HUMAN::Q9NPC1
Residue:389
Sequence:
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL
AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL
GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA
LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR
GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA
RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT
TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009073
NameBDBM50009073
Synonyms:4-(5-cyclopentyloxycarbonylamino-1-methyl-1H-indol-3-ylmethyl)-3-methoxy-N-o-tolylsulfonylbenzamide | CHEMBL603 | ZAFIRLUKAST | cyclopentyl 3-(2-methoxy-4-((o-tolylsulfonyl)carbamoyl)benzyl)-1-methylindole-5-carbamate | cyclopentyl 3-[2-methoxy-4-(2-methylphenylsulfonylcarbamoyl)benzyl]-1-methyl-1H-indol-5-ylcarbamate
TypeSmall organic molecule
Emp. Form.C31H33N3O6S
Mol. Mass.575.675
SMILESCOc1cc(ccc1Cc1cn(C)c2ccc(NC(=O)OC3CCCC3)cc12)C(=O)NS(=O)(=O)c1ccccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a