Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium release-activated calcium channel
LigandBDBM50094703
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2986
Citation Jarvis, MFYu, HKohlhaas, KAlexander, KLee, CHJiang, MBhagwat, SSWilliams, MKowaluk, EA ABT-702 (4-amino-5-(3-bromophenyl)-7-(6-morpholinopyridin-3-yl)pyrido[2, 3-d]pyrimidine), a novel orally effective adenosine kinase inhibitor with analgesic and anti-inflammatory properties: I. In vitro characterization and acute antinociceptive effects in the mouse. J Pharmacol Exp Ther295:1156-64 (2000) [PubMed]
More Info.:Get all data from this article
 
Calcium release-activated calcium channel
Name:Calcium release-activated calcium channel
Synonyms:CRACM1 | Calcium channel (VER) | Calcium release-activated calcium channel protein 1 | ORAI1 | Protein orai-1 | TMEM142A | Transmembrane protein 142A
Type:Protein
Mol. Mass.:32676.63
Organism:Homo sapiens (Human)
Description:Q96D31
Residue:301
Sequence:
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094703
NameBDBM50094703
Synonyms:5-(3-Bromo-phenyl)-7-(6-morpholin-4-yl-pyridin-3-yl)-pyrido[2,3-d]pyrimidin-4-ylamine | 5-(3-bromophenyl)-7-(6-morpholin-4-ylpyridin-3-yl)pyrido[2,3-d]pyrimidin-4-ylamine | ABT-702 | CHEMBL66089
TypeSmall organic molecule
Emp. Form.C22H19BrN6O
Mol. Mass.463.33
SMILESNc1ncnc2nc(cc(-c3cccc(Br)c3)c12)-c1ccc(nc1)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a