Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 8 (mGlu8)
LigandBDBM50013055
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_2014
Citation Naples, MAHampson, DR Pharmacological profiles of the metabotropic glutamate receptor ligands. Neuropharmacology40:170-7 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
Metabotropic glutamate receptor 8 (mGlu8)
Name:Metabotropic glutamate receptor
Synonyms:GRM8 | glutamate receptor, metabotropic 8 precursor | mGlu8 | mGluR8 | metabotropic glutamate 8
Type:Enzyme
Mol. Mass.:101886.18
Organism:Rattus norvegicus (Rat)
Description:P70579
Residue:908
Sequence:
MVCEGKRLASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KERCPGYIGLCPRMVTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINN
KSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAVVPVFIAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
TIIDYGEQRTLDPENARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013055
NameBDBM50013055
Synonyms:2-aminopentanedioateglutamate | L-Glutamate | glutamate(2-) | glutamic acid dianion
TypeSmall organic molecule
Emp. Form.C5H7NO4
Mol. Mass.145.1145
SMILESNC(CCC([O-])=O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a