Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 receptor
LigandBDBM7966
Substrate/Competitorn/a
Ki 0.14±n/a nM
CommentsPDSP_934
Citation Zhu, YMichalovich, DWu, HTan, KBDytko, GMMannan, IJBoyce, RAlston, JTierney, LALi, XHerrity, NCVawter, LSarau, HMAmes, RSDavenport, CMHieble, JPWilson, SBergsma, DJFitzgerald, LR Cloning, expression, and pharmacological characterization of a novel human histamine receptor. Mol Pharmacol59:434-41 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H4 receptor
Name:Histamine H4 receptor
Synonyms:HISTAMINE H4 | HRH4
Type:Enzyme Catalytic Domain
Mol. Mass.:44536.99
Organism:GUINEA PIG
Description:HISTAMINE H4 HRH4 GUINEA PIG::Q91ZY3
Residue:389
Sequence:
MLANNSTIALTSIKISLTFLMSLLAIAIMLGNVVVILAFIVDRNLRHRSNYFFLNLAIAD
FFVGAIAIPLYIPSSLTYWTSGKQACVFWLITDYLLCTASVYNIVLISYDRYQSVSNAVW
YRAQHSGTWKIATQMVAVWIFSFMTNGPMILISDSWQNSTTECEPGFLKKWYFALPTSLL
EFLIPILLVAYFSAHIYWSLWKREKLSRCLSHPVLPSDSSSSDHGHSCRQDPDSRATLPA
RKETTASLGSDKSRRKSSLLFSIRAYKNSNVIASKMGFLSHSDSLALQQREHIELFRARK
LAKSLAILLAAFAICWAPYSLTTVIYSFFPERNLTKSTWYHTAFWLQWFNSFVNPFLYPL
CHKRFQKAFLKILPVRRQSTPPHNRSIST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7966
NameBDBM7966
Synonyms:2-(1H-imidazol-4-yl)ethan-1-amine | CHEMBL544208 | CHEMBL90 | Ceplene | Ergotidine | HISTAMINE | HISTAMINE DIHYDROCHLORIDE | Histamine | L-histamine | Peremin | [3H]histamine
TypeSmall organic molecule
Emp. Form.C5H9N3
Mol. Mass.111.1451
SMILESNCCc1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a