Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADORA3
LigandBDBM50053924
Substrate/Competitorn/a
Ki 3307±n/a nM
CommentsPDSP_2056
Citation Durand, IHGreen, RD Cloning of a chick A3 adenosine receptor: characterization of ligand binding and receptor-effector coupling of chick A1 and A3 adenosine receptors. Naunyn Schmiedebergs Arch Pharmacol363:81-6 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
ADORA3
Name:ADORA3
Synonyms:ADENOSINE A3
Type:Enzyme Catalytic Domain
Mol. Mass.:37893.81
Organism:Chick
Description:F1NSB8
Residue:339
Sequence:
MCPQGSPCPASSSPINVTFNTSQVMGSIDVIYISAECLVALLAALGNIPVVWAVKLNAAF
HNTTMYFIASLALADIAVGVFVVPLAVLVSLQVSIPFHFCLFLCCLMVVFTQASILSLLA
IAIDRYLRVKLPIRYKIISTERRIWGALGLCWSLSLLVGLTPMFGWNKQRSAPYHTCGFT
SVIRMDYMVYFSFFAWTLIPLSIMCALYVAVFYIIRTKLSQGATGARGAGTFYGKEFRKA
KSLALVLFLFAVSWLPLCIMNCVLYFHPEYKIPKPWIFLGILLSHANSAMNPVVYACKIK
KFKTTYLLILRTYILCRKKPQAMPSSYRLNTPAVVQNER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053924
NameBDBM50053924
Synonyms:3,6-Dichloro-2-(2-isopropoxy-4-methyl-phenyl)-chromen-4-one | CHEMBL89093 | MRS1067
TypeSmall organic molecule
Emp. Form.C19H16Cl2O3
Mol. Mass.363.235
SMILESCC(C)Oc1cc(C)ccc1-c1oc2ccc(Cl)cc2c(=O)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a