Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIA3
LigandBDBM50013055
Substrate/Competitorn/a
Ki 90±n/a nM
CommentsPDSP_2014
Citation Wright, RAArnold, MBWheeler, WJOrnstein, PLSchoepp, DD [3H]LY341495 binding to group II metabotropic glutamate receptors in rat brain. J Pharmacol Exp Ther298:453-60 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
GRIA3
Name:GRIA3
Synonyms:Glutamate receptor 3 | Glutamate receptor ionotropic, AMPA 3 | Glutamate-AMPA
Type:Enzyme Catalytic Domain
Mol. Mass.:100383.57
Organism:RAT
Description:Glutamate-AMPA GRIA3 RAT::P19492
Residue:888
Sequence:
MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTE
KPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVT
PSFPTDADVQFVIQMRPALKGAILSLLSYYKWEKFVYLYDTERGFSVLQAIMEAAVQNNW
QVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYM
LANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYT
SALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGM
TGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSSSSENRTIV
VTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPE
TKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFS
FLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIF
NSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIE
SAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVR
KSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNLAVLKLN
EQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEF
CYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013055
NameBDBM50013055
Synonyms:2-aminopentanedioateglutamate | L-Glutamate | glutamate(2-) | glutamic acid dianion
TypeSmall organic molecule
Emp. Form.C5H7NO4
Mol. Mass.145.1145
SMILESNC(CCC([O-])=O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a