Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenal Outer Medullary Potassium (ROMK)
LigandBDBM82071
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_1947
Citation Bymaster, FPDreshfield-Ahmad, LJThrelkeld, PGShaw, JLThompson, LNelson, DLHemrick-Luecke, SKWong, DT Comparative affinity of duloxetine and venlafaxine for serotonin and norepinephrine transporters in vitro and in vivo, human serotonin receptor subtypes, and other neuronal receptors. Neuropsychopharmacology25:871-80 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
Renal Outer Medullary Potassium (ROMK)
Name:Renal Outer Medullary Potassium (ROMK)
Synonyms:ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1)
Type:Enzyme
Mol. Mass.:44976.27
Organism:Rattus norvegicus (Rat)
Description:P35560
Residue:391
Sequence:
MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82071
NameBDBM82071
Synonyms:CAS_93413-69-5 | CAS_99300-78-4 | NSC_62923 | VENLAFAXINE | Venlafaxine hydrochloride | WY-45030 | WY-45655
TypeSmall organic molecule
Emp. Form.C17H27NO2
Mol. Mass.277.4018
SMILESCOc1ccc(cc1)C(CN(C)C)C1(O)CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a