Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurotensin receptor 1
LigandBDBM82078
Substrate/Competitorn/a
Ki 0.25±n/a nM
CommentsPDSP_1308
Citation Pettibone, DJHess, JFHey, PJJacobson, MALeviten, MLis, EVMallorga, PJPascarella, DMSnyder, MAWilliams, JBZeng, Z The effects of deleting the mouse neurotensin receptor NTR1 on central and peripheral responses to neurotensin. J Pharmacol Exp Ther300:305-13 (2002) [PubMed]  Article
More Info.:Get all data from this article
 
Neurotensin receptor 1
Name:Neurotensin receptor 1
Synonyms:NT-R-1 | Neurotensin 1 | Neurotensin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:47237.04
Organism:MOUSE
Description:Neurotensin 1 NTSR1 MOUSE::A2ACT4
Residue:424
Sequence:
MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSESILEPNSNLDVNTDI
YSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAM
PVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLM
SRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGLVCTPTVDTATVKVVIQVN
TFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVGTHNSLEHSTFNMSIEPGRV
QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV
SSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRPTFSRKPNSMSSNHAFSTSATR
ETLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82078
NameBDBM82078
Synonyms:CAS_55508-42-4 | NSC_128644 | Neurotensin
TypeSmall organic molecule
Emp. Form.C36H58N8O9
Mol. Mass.746.8939
SMILESCCC(C)C(NC(=O)C(Cc1ccc(O)cc1)NC(=O)C1CCCN1C(=O)C(CC(N)=O)NC(=O)C(N)CCCCN)C(=O)NC(CC(C)C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a