Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoxygenase
LigandBDBM4375
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Temperature298.15±0 K
IC50 600000±15000 nM
Citation Koukoulitsa, CHadjipavlou-Litina, DGeromichalos, GDSkaltsa, H Inhibitory effect on soybean lipoxygenase and docking studies of some secondary metabolites, isolated from Origanum vulgare L. ssp. hirtum. J Enzyme Inhib Med Chem22:99-104 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Lipoxygenase
Name:Lipoxygenase
Synonyms:n/a
Type:Protein
Mol. Mass.:96526.62
Organism:Glycine max (Soybean) (Glycine hispida)
Description:P38417
Residue:853
Sequence:
MFPFGQKGQKIKGTMVVMQKNVLDINSITSVGGIVDQGLGFIGSAVDALTFAATKISIQL
ISATKADGGKGKIGKSTNLRGKITLPTLGAGEQAYDVNFEWDSDFGIPGAFYIKNFMQNE
FYLKSLILEDIPNHGTIHFVCNSWVYNSKNYKTDRIFFANNTYLPSETPAPLLKYREEEL
KNVRGDGTGERKEWDRIYDYDVYNDLGNPDSGDKYARPVLGGSALPYPRRERTGRGKTRK
DPNSEKPSDFVYLPRDEAFGHLKSSDFLAYGIKSVSQDVLPVLTDAFDGNILSLEFDNFA
EVHKLYEGGVTLPTNFLSKIAPIPVIKEIFRTDGEQFLKYPPPKVMQVDKSAWMTDEEFA
RETIAGLNPNVIKIIEEFPLSSKLDTQAYGDHTCIIAKEHLEPNLGGLTVEQAIQNKKLF
ILDHHDYLIPYLRKINANTTKTYATRTIFFLKDDGTLTPLAIELSKPHPQGEEYGPVSEV
YVPASEGVEAYIWLLAKAYVVVNDACYHQIISHWLSTHAIVEPFVIATNRQLSVVHPIYK
LLFPHYRDTMNINSLARKALVNADGIIEKTFLWGRYSMEMSAVIYKDWVFTDQALPNDLV
KRGVAVKDPSAPHGVRLLIEDYPYASDGLEIWDAIKSWVQEYVSFYYKSDEELQKDPELQ
AWWKELVEVGHGDLKDKPWWQKMQTREELVEASAILIWIASALHAAVNFGQYPYGGLILN
RPTISRRFMPEKGSPEYDALAKNPEKEFLKTITGKKETLIDLTVIEILSRHASDEFYLGQ
RDGGDYWTSDAGPLEAFKRFGKKLEEIEKKLIEKNKDETLRNRYGPAKMPYTLLYPSSEE
GLTFRGIPNSISI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4375
NameBDBM4375
Synonyms:(2E)-3-(3,4-dihydroxyphenyl)prop-2-enoic acid | (2E)-3-(3,4-dihydroxyphenyl)prop-2-enoic acid (9) | 3,4-Dihydroxycinnamate, XVII | CHEMBL145 | Caffeic acid | Caffeic acid, 1 | cid_689043
TypeSmall organic molecule
Emp. Form.C9H8O4
Mol. Mass.180.1574
SMILESOC(=O)\C=C\c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a