Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT1B
LigandBDBM50240609
Substrate/Competitorn/a
Ki 0.12±n/a nM
CommentsPDSP_3386
Citation Inada, YNakane, TChiba, S Binding of KRH-594, an antagonist of the angiotensin II type 1 receptor, to cloned human and rat angiotensin II receptors. Fundam Clin Pharmacol16:317-23 (2002) [PubMed]
More Info.:Get all data from this article
 
Angiotensin II AT1B
Name:Angiotensin II receptor (AT-1) type-1
Synonyms:AT1B | AT3 | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | Type-1B angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:40929.44
Organism:RAT
Description:Angiotensin II AT1B 0 RAT::P29089
Residue:359
Sequence:
MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240609
NameBDBM50240609
Synonyms:2-Ethoxy-3-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-benzoimidazole-4-carboxylic acid(CV-11974) | 2-Ethoxy-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-benzoimidazole-4-carboxylic acid | 2-ethoxy-3-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-benzoimidazole-4-carboxylic acid | CANDESARTAN | CHEMBL1016 | CV-11974
TypeSmall organic molecule
Emp. Form.C24H20N6O3
Mol. Mass.440.454
SMILESCCOc1nc2cccc(C(O)=O)c2n1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a