Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoxygenase
LigandBDBM86069
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH8±0
Temperature298.15±0 K
IC50 3.30e+4± 0 nM
Citation Maharvi, GMAli, SRiaz, NAfza, NMalik, AAshraf, MIqbal, LLateef, M Mild and efficient synthesis of new tetraketones as lipoxygenase inhibitors and antioxidants. J Enzyme Inhib Med Chem23:62-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Lipoxygenase
Name:Lipoxygenase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:80366.80
Organism:Homo sapiens (Human)
Description:AAC79680.1
Residue:701
Sequence:
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD
LGELIIIRLHKERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKT
TADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGY
IPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGE
GTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQ
TPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMC
HPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLY
LPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEI
FKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMR
NPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRR
SIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86069
NameBDBM86069
Synonyms:Tetraketone, 2
TypeSmall organic molecule
Emp. Form.C23H28O4
Mol. Mass.368.466
SMILESCC1(C)CC(=O)C(C(C2C(=O)CC(C)(C)CC2=O)c2ccccc2)C(=O)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a