Target
Ionotropic glutamate receptor subunit Delta2
Ligand
BDBM79403
Substrate
n/a
Ki
>10000±n/a nM
Comments
PDSP_3015
Citation
 Williams, KDattilo, MSabado, TNKashiwagi, KIgarashi, K Pharmacology of delta2 glutamate receptors: effects of pentamidine and protons. J Pharmacol Exp Ther 305:740-8 (2003) [PubMed]  Article
Target
Name:
Ionotropic glutamate receptor subunit Delta2
Synonyms:
Glutamate delta 2 | Glutamate receptor delta-2 subunit
Type:
Enzyme Catalytic Domain
Mol. Mass.:
19076.25
Organism:
Xenopus
Description:
B9V8R6
Residue:
168
Sequence:
FDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTISRIESSIQSLQDLSRQTDIPYGTVFDSAVYEHVRVKGMNPFERDSMYSQMWRMINRSNGSENNVQESLEGIQKV
  
Inhibitor
Name:
BDBM79403
Synonyms:
3-aminopropyl-[4-(3-aminopropylamino)butyl]amine;hydrochloride | CHEMBL23194 | MLS002472980 | N,N''-bis(3-aminopropyl)butane-1,4-diamine;hydrochloride | N,N''-bis(3-azanylpropyl)butane-1,4-diamine;hydrochloride | N,N'-bis(3-aminopropyl)butane-1,4-diamine | SMR001397086 | Spermine | cid_5351186 | spermidine 3HCl
Type:
Small organic molecule
Emp. Form.:
C10H26N4
Mol. Mass.:
202.3402
SMILES:
NCCCNCCCCNCCCN
Structure:
Search PDB for entries with ligand similarity: