Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor
LigandBDBM50275262
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_3403
Citation Jensen, AAMikkelsen, IFrølund, BBräuner-Osborne, HFalch, EKrogsgaard-Larsen, P Carbamoylcholine homologs: novel and potent agonists at neuronal nicotinic acetylcholine receptors. Mol Pharmacol64:865-75 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Neuronal acetylcholine receptor
Name:Neuronal acetylcholine receptor
Synonyms:Cholinergic, Nicotinic Alpha7 | Cholinergic, Nicotinic Alpha7/5-HT3 | Neuronal acetylcholine receptor (alpha7 nAChR) | Neuronal acetylcholine receptor subunit alpha 7 | Neuronal acetylcholine receptor subunit alpha-7 | Neuronal acetylcholine receptor subunit alpha-7 (nAChR alpha7) | Neuronal acetylcholine receptor subunit alpha-7 (nAChR)
Type:Enzyme
Mol. Mass.:56502.44
Organism:Rattus norvegicus (Rat)
Description:Q05941
Residue:502
Sequence:
MCGGRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDL
QMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHK
PRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHL
MHGAHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50275262
NameBDBM50275262
Synonyms:3-(dimethylamino)butyl dimethylcarbamate | 3-N,N-dimethylaminobutyl-N,N-dimethylcarbamate | CHEMBL486572
TypeSmall organic molecule
Emp. Form.C9H20N2O2
Mol. Mass.188.2673
SMILESCC(CCOC(=O)N(C)C)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a