BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha trans-inducing protein (VP16)
LigandBDBM36921
Substrate/Competitorn/a
Meas. Tech.Counterscreen for inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3)
IC50 9519±n/a nM
Citation PubChem, PC Counterscreen for inhibitors of the Steroid Receptor Coactivator 3 (SRC3; NCOA3): Luminescence-based cell-based high throughput dose response assay to identify inhibitors of the Herpes Virus Virion Protein 16 (VP16) PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
Alpha trans-inducing protein (VP16)
Name:Alpha trans-inducing protein (VP16)
Synonyms:transactivating tegument protein VP16
Type:PROTEIN
Mol. Mass.:54325.13
Organism:Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus1)
Description:EBI_100271
Residue:490
Sequence:
MDLLVDELFADMNADGASPPPPRPAGGPKNTPAAPPLYATGRLSQAQLMPSPPMPVPPAA
LFNRLLDDLGFSAGPALCTMLDTWNEDLFSALPTNADLYRECKFLSTLPSDVVEWGDAYV
PERTQIDIRAHGDVAFPTLPATRDGLGLYYEALSRFFHAELRAREESYRTVLANFCSALY
RYLRASVRQLHRQAHMRGRDRDLGEMLRATIADRYYRETARLARVLFLHLYLFLTREILW
AAYAEQMMRPDLFDCLCCDLESWRQLAGLFQPFMFVNGALTVRGVPIEARRLRELNHIRE
HLNLPLVRSAATEEPGAPLTTPPTLHGNQARASGYFMVLIRAKLDSYSSFTTSPSEAVMR
EHAYSRARTKNNYGSTIEGLLDLPDDDAPEEAGLAAPRLSFLPAGHTRRLSTAPPTDVSL
GDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMFT
DALGIDEYGG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36921
NameBDBM36921
Synonyms:6-cyclohexyl-3-(3-methoxyphenyl)-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | MLS000081210 | SMR000043363 | cid_662755
TypeSmall organic molecule
Emp. Form.C16H18N4OS
Mol. Mass.314.405
SMILESCOc1cccc(c1)-c1nnc2sc(nn12)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a