BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin
LigandBDBM39775
Substrate/Competitorn/a
Meas. Tech.Dose Response validation of uHTS RPN11 inhibitor hits using a Thrombin Fluorescence Polarization assay
IC50 529±78 nM
Citation PubChem, PC Dose Response validation of uHTS RPN11 inhibitor hits using a Thrombin Fluorescence Polarization assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
Thrombin
Name:Thrombin
Synonyms:Activation peptide fragment 1 | Activation peptide fragment 2 | Coagulation factor II | Prothrombin | Thrombin heavy chain | Thrombin light chain
Type:Enzyme
Mol. Mass.:70502.73
Organism:Bos taurus (Bovine)
Description:P00735
Residue:625
Sequence:
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQASSLLQRARRANKGFLEEVRKGNLERE
CLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGN
VSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRRE
ECSVPVCGQDRVTVEVIPRSGGSTTSQSPLLETCVPDRGREYRGRLAVTTSGSRCLAWSS
EQAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCYVADQPGDFEYCDLNYCEEPVDGDL
GDRLGEDPDPDAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFE
SYIEGRIVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNF
TVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDY
IHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCK
ASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRD
GKYGFYTHVFRLKKWIQKVIDRLGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM39775
NameBDBM39775
Synonyms:(5E)-5-[(E)-3-[4-(dimethylamino)phenyl]prop-2-enylidene]-3-phenyl-2-sulfanylidene-1,3-thiazolidin-4-one | (5E)-5-[(E)-3-[4-(dimethylamino)phenyl]prop-2-enylidene]-3-phenyl-2-sulfanylidene-4-thiazolidinone | (5E)-5-[(E)-3-[4-(dimethylamino)phenyl]prop-2-enylidene]-3-phenyl-2-thioxo-thiazolidin-4-one | 5-[3-(4-Dimethylamino-phenyl)-allylidene]-3-phenyl-2-thioxo-thiazolidin-4-one | MLS000557712 | SMR000174254 | cid_5752007
TypeSmall organic molecule
Emp. Form.C20H18N2OS2
Mol. Mass.366.5
SMILESCN(C)c1ccc(\C=C\C=C2\SC(=S)N(C2=O)c2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a