BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTPA: Essential protein of the mitochondrial intermembrane space
LigandBDBM89099
Substrate/Competitorn/a
Meas. Tech.SAR analysis of small molecule inhibitors of tim23-1: a luminescent tim10-1 yeast counterscreen.
IC50>99000±n/a nM
Citation PubChem, PC SAR analysis of small molecule inhibitors of tim23-1: a luminescent tim10-1 yeast counterscreen. PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
TPA: Essential protein of the mitochondrial intermembrane space
Name:TPA: Essential protein of the mitochondrial intermembrane space
Synonyms:TPA: Essential protein of the mitochondrial intermembrane space, forms a complex with Tim9p (TIM10 complex) that delivers hydrophobic proteins to the TIM22 complex for insertion into the inner ...
Type:Enzyme Catalytic Domain
Mol. Mass.:10303.50
Organism:Saccharomyces cerevisiae S288c
Description:gi_285809906
Residue:93
Sequence:
MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESS
CLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM89099
NameBDBM89099
Synonyms:2-[(3-chloranylpyridin-2-yl)sulfonylmethyl]-7-methyl-pyrido[1,2-a]pyrimidin-4-one | 2-[(3-chloro-2-pyridinyl)sulfonylmethyl]-7-methyl-4-pyrido[1,2-a]pyrimidinone | 2-[(3-chloro-2-pyridyl)sulfonylmethyl]-7-methyl-pyrido[1,2-a]pyrimidin-4-one | 2-[(3-chloropyridin-2-yl)sulfonylmethyl]-7-methylpyrido[1,2-a]pyrimidin-4-one | MLS-0463367.0001 | cid_47024356
TypeSmall organic molecule
Emp. Form.C15H12ClN3O3S
Mol. Mass.349.792
SMILESCc1ccc2nc(CS(=O)(=O)c3ncccc3Cl)cc(=O)n2c1
Structure
n/a