BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targettyrosine-protein phosphatase non-receptor type 5 isoform a
LigandBDBM46225
Substrate/Competitorn/a
Meas. Tech.Dose response orthogonal assay of uHTS small molecule inhibitors of Striatal-Enriched Phosphatase via a colorimetric intensity assay.
IC50>80000±n/a nM
Citation PubChem, PC Dose response orthogonal assay of uHTS small molecule inhibitors of Striatal-Enriched Phosphatase via a colorimetric intensity assay. PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
tyrosine-protein phosphatase non-receptor type 5 isoform a
Name:tyrosine-protein phosphatase non-receptor type 5 isoform a
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:63510.68
Organism:Homo sapiens (Human)
Description:gi_90652859
Residue:565
Sequence:
MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPP
PPSPPSDPAQKPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNATNLV
SSLLTLLKQLEPTAWLDSGTWGVPSLLLVFLSVGLVLVTTLVWHLLRTPPEPPTPLPPED
RRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQ
ERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLL
QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIR
GYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYD
GVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEE
AAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQ
TCEQYQFVHHVMSLYEKQLSHQSPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM46225
NameBDBM46225
Synonyms:MLS-0266851.0001 | cid_2545467
TypeSmall organic molecule
Emp. Form.C23H18N2O7S2
Mol. Mass.498.528
SMILESCCOC(=O)c1sc2nc3c(SCC(O)=O)cc(cn3c(=O)c2c1C)C(=O)c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a