Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholine Binding protein
LigandBDBM50143314
Substrate/Competitorn/a
Meas. Tech.Radioligand Competition Assay
Ki 0.097±0 nM
Citation Rohde, LAAhring, PKJensen, MLNielsen, EØPeters, DHelgstrand, CKrintel, CHarpsøe, KGajhede, MKastrup, JSBalle, T Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine α4β2 receptors: unique role of halogen bonding revealed. J Biol Chem287:4248-59 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholine Binding protein
Name:Acetylcholine Binding protein
Synonyms:ACh-binding protein | Acetylcholine-binding protein | Acetylcholine-binding protein (AchBP) | Acetylcholine-binding protein (Ls-AchBP) | AchBP
Type:n/a
Mol. Mass.:26055.52
Organism:Lymnaea stagnalis
Description:Soluble acetylcholine receptor
Residue:229
Sequence:
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50143314
NameBDBM50143314
Synonyms:(+)-Epibatidine | (-)-epibatidine | (1R,2R,4S)-2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane | 2-(6-Chloro-pyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane (epibatidine) | CHEMBL298826 | EPIBATIDINE
TypeSmall organic molecule
Emp. Form.C11H13ClN2
Mol. Mass.208.687
SMILESClc1ccc(cn1)[C@H]1C[C@@H]2CC[C@H]1N2 |THB:4:7:13:11.10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a