Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
LigandBDBM92447
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
pH6.8±0
Temperature310.15±0 K
Ki 3218±0.0 nM
Citation Devel, LBeau, FAmoura, MVera, LCassar-Lajeunesse, EGarcia, SCzarny, BStura, EADive, V Simple Pseudo-dipeptides with a P2' Glutamate: A NOVEL INHIBITOR FAMILY OF MATRIX METALLOPROTEASES AND OTHER METZINCINS. J Biol Chem287:26647-56 (2012) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Name:A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Synonyms:ADAMTS5 | Aggrecanase-2 | Metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Type:Enzyme
Mol. Mass.:101769.09
Organism:Homo sapiens (Human)
Description:Q9UNA0
Residue:930
Sequence:
MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGH
PHPLAQRRRSKGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGT
SAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGR
VYGDGSARILHVYTREGFSFEALPPRASCETPASTPEAHEHAPAHSNPSGRAALASQLLD
QSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMARLYGRGLQHYLLTLASIANR
LYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYD
AAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH
DDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQI
LGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGT
PCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPR
NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVL
PADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVRGKCVRTGCDGIIGSKLQYDK
CGVCGGDNSSCTKIVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKK
NGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT
KPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTV
QCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92447
NameBDBM92447
Synonyms:Inhibitor, 17
TypeSmall organic molecule
Emp. Form.C19H22N2O4S
Mol. Mass.374.454
SMILESCc1ccc(s1)-c1ccc(CCC(=O)N[C@@H](CCC(O)=O)C(N)=O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a