Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-converting enzyme 2 (ECE-2)
LigandBDBM92500
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
Ki 195±9 nM
IC50 380±16 nM
Citation Ouimet, TOrng, SVPoras, HGagnidze, KDevi, LAFournié-Zaluski, MCRoques, BP Identification of an endothelin-converting enzyme-2-specific fluorigenic substrate and development of an in vitro and ex vivo enzymatic assay. J Biol Chem285:34390-400 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Endothelin-converting enzyme 2 (ECE-2)
Name:Endothelin-converting enzyme 2 (ECE-2)
Synonyms:Endothelin-converting enzyme 2 | Endothelin-converting enzyme 2 (ECE2) | Endothelin-converting enzyme 2 region
Type:Enzyme
Mol. Mass.:99745.05
Organism:Homo sapiens (Human)
Description:O60344
Residue:883
Sequence:
MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPED
RILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFP
SASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSEVGFQKGTRQLLGSRTQLELV
LAGASLLLAALLLGCLVALGVQYHRDPSHSTCLTEACIRVAGKILESLDRGVSPCEDFYQ
FSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENTTFNSSSEAEQKTQRFYLSCL
QVERIEELGAQPLRDLIEKIGGWNITGPWDQDNFMEVLKAVAGTYRATPFFTVYISADSK
SSNSNVIQVDQSGLFLPSRDYYLNRTANEKVLTAYLDYMEELGMLLGGRPTSTREQMQQV
LELEIQLANITVPQDQRRDEEKIYHKMSISELQALAPSMDWLEFLSFLLSPLELSDSEPV
VVYGMDYLQQVSELINRTEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKS
CVPRWQTCISNTDDALGFALGSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDE
KTRQAAKEKADAIYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMAD
QLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPFYARNHPKALNFGGIGVVMGH
ELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGERLNGRQTLGE
NIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGL
VTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92500
NameBDBM92500
Synonyms:Kelatorphan
TypeOrganic molecule
Emp. Form.C14H18N2O5
Mol. Mass.294.3031
SMILESC[C@H](NC(=O)[C@@H](CC(=O)NO)Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a