Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-protein thioesterase 1
LigandBDBM92728
Substrate/Competitorn/a
Meas. Tech.Enzymatic Protein Activity Assay
IC50 3.36e+4± 4.6e+3 nM
Citation Zimmermann, TJBürger, MTashiro, EKondoh, YMartinez, NEGörmer, KRosin-Steiner, SShimizu, TOzaki, SMikoshiba, KWatanabe, NHall, DVetter, IROsada, HHedberg, CWaldmann, H Boron-based inhibitors of acyl protein thioesterases 1 and 2. Chembiochem14:115-22 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-protein thioesterase 1
Name:Acyl-protein thioesterase 1
Synonyms:APT-1 | Acyl-protein thioesterase 1 (APT1 WT) | LPL-I | LysoPLA I | Lysophospholipase 1 | Lysophospholipase I | hAPT1
Type:Protein
Mol. Mass.:24670.33
Organism:Homo sapiens (Human)
Description:O75608
Residue:230
Sequence:
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLM
FGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92728
NameBDBM92728
Synonyms:Phenylboronic acid, 7
TypeSmall molecule
Emp. Form.C26H24B2O3
Mol. Mass.406.089
SMILESOB(c1ccccc1)c1cccc(COCc2cccc(c2)B(O)c2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a