Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-chymotrypsin
LigandBDBM93015
Substrate/Competitorn/a
Meas. Tech.Kinetic Assay
Ki 4900000±1100000 nM
Citation ABRASH, HINIEMANN, C INTERACTION OF AROMATIC COMPOUNDS WITH ALPHA-CHYMOTRYPSIN. II. COMBINATION OF THE ISOMERIC INDOLE CARBOXAMIDES AND CARBOXYLATE IONS WITH THE ACTIVE SITE. Biochemistry4:99-104 (1965) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-chymotrypsin
Name:Alpha-chymotrypsin
Synonyms:Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin)
Type:Serine protease
Mol. Mass.:25670.88
Organism:Bos taurus (bovine)
Description:n/a
Residue:245
Sequence:
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93015
NameBDBM93015
Synonyms:Indole-3-carboxylate
TypeSmall molecule
Emp. Form.C9H7NO2
Mol. Mass.161.1574
SMILESOC(=O)c1c[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a