Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetComplement C1s
LigandBDBM93097
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
pH8.05±0
Temperature298.65±0 K
Ki 4370000±0.0 nM
Citation Bing, DH Nature of the active site of a subunit of the first component of human complement. Biochemistry8:4503-10 (1969) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Complement C1s
Name:Complement C1s
Synonyms:C1 esterase | Complement C1s subcomponent | Complement C1s subcomponent heavy chain | Complement C1s subcomponent light chain | Complement component 1 subcomponent s | Trypsin | complement component 1, s subcomponent
Type:Protein
Mol. Mass.:76657.91
Organism:Homo sapiens (Human)
Description:P09871
Residue:688
Sequence:
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM93097
NameBDBM93097
Synonyms:Guanidinacetic
TypeSmall molecule
Emp. Form.C3H6N3O2
Mol. Mass.116.0992
SMILESNC(=N)NCC([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a