Target
Corticotropin-releasing factor-binding protein
Ligand
BDBM90880
Substrate
n/a
IC50
20000±n/a nM
Citation
 PubChem, PC Dose Response confirmation of uHTS hits for small molecule antagonists of the CRF-binding protein and CRF-R2 receptor complex in 384 well format PubChem Bioassay (2012)[AID]
Target
Name:
Corticotropin-releasing factor-binding protein
Synonyms:
corticotropin releasing factor-binding protein
Type:
Enzyme Catalytic Domain
Mol. Mass.:
36143.95
Organism:
Homo sapiens (Human)
Description:
P24387
Residue:
322
Sequence:
MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
  
Inhibitor
Name:
BDBM90880
Synonyms:
7-(1-azepanyl)-3-(3,4-dimethoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidine | 7-(azepan-1-yl)-3-(3,4-dimethoxyphenyl)-2,5-dimethyl-pyrazolo[1,5-a]pyrimidine | 7-(azepan-1-yl)-3-(3,4-dimethoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidine | 7-azepan-1-yl-3-(3,4-dimethoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidine | MLS001199361 | SMR000562847 | cid_7476690
Type:
Small organic molecule
Emp. Form.:
C22H28N4O2
Mol. Mass.:
380.4833
SMILES:
COc1ccc(cc1OC)-c1c(C)nn2c(cc(C)nc12)N1CCCCCC1
Structure:
Search PDB for entries with ligand similarity: