BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targettumor necrosis factor receptor superfamily member 10B isoform 1 precursor [Homo sapiens]
LigandBDBM46225
Substrate/Competitorn/a
EC50>12500±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS hits for a small molecule Caspase-8 TRAIL sensitizers in a luminescence panel assay PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
tumor necrosis factor receptor superfamily member 10B isoform 1 precursor [Homo sapiens]
Name:tumor necrosis factor receptor superfamily member 10B isoform 1 precursor [Homo sapiens]
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:47869.76
Organism:Homo sapiens (Human)
Description:gi_224494019
Residue:440
Sequence:
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV
LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK
LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED
HLLSSGKFMYLEGNADSAMS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM46225
NameBDBM46225
Synonyms:MLS-0266851.0001 | cid_2545467
TypeSmall organic molecule
Emp. Form.C23H18N2O7S2
Mol. Mass.498.528
SMILESCCOC(=O)c1sc2nc3c(SCC(O)=O)cc(cn3c(=O)c2c1C)C(=O)c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a