BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM55068
Substrate/Competitorn/a
IC50>80000±n/a nM
Citation PubChem, PC Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM55068
NameBDBM55068
Synonyms:2-(4-butoxyphenyl)-1-(2-furanylmethyl)-4-hydroxy-3-[(5-methyl-2-furanyl)-oxomethyl]-2H-pyrrol-5-one | 2-(4-butoxyphenyl)-1-(furan-2-ylmethyl)-3-(5-methylfuran-2-yl)carbonyl-4-oxidanyl-2H-pyrrol-5-one | 2-(4-butoxyphenyl)-1-(furan-2-ylmethyl)-4-hydroxy-3-(5-methylfuran-2-carbonyl)-2H-pyrrol-5-one | 5-(4-butoxyphenyl)-1-(2-furfuryl)-3-hydroxy-4-(5-methyl-2-furoyl)-3-pyrrolin-2-one | 5-(4-butoxyphenyl)-1-(2-furylmethyl)-3-hydroxy-4-(5-methyl-2-furoyl)-1,5-dihydro-2H-pyrrol-2-one | MLS001147316 | SMR000672577 | cid_3291242
TypeSmall organic molecule
Emp. Form.C25H25NO6
Mol. Mass.435.4691
SMILESCCCCOc1ccc(cc1)C1C(C(=O)c2ccc(C)o2)C(=O)C(=O)N1Cc1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a